PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OMERI01G33390.3
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family NF-YB
Protein Properties Length: 205aa    MW: 22306.5 Da    PI: 6.5115
Description NF-YB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OMERI01G33390.3genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NF-YB175.64.8e-5536129194
            NF-YB   1 vreqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkkyrele 94 
                      vreqdrflPian+srimkk++Pan+ki+kdaket+qecvsefisfvtseasdkcq+ekrkting+dll+a++tlGfe+yv+plk+yl+kyre +
  OMERI01G33390.3  36 VREQDRFLPIANISRIMKKAVPANGKIAKDAKETLQECVSEFISFVTSEASDKCQKEKRKTINGEDLLFAMGTLGFEEYVDPLKIYLHKYREGD 129
                      69*****************************************************************************************965 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.20.102.0E-5234138IPR009072Histone-fold
SuperFamilySSF471135.74E-3939134IPR009072Histone-fold
PfamPF008085.0E-2842106IPR003958Transcription factor CBF/NF-Y/archaeal histone domain
PRINTSPR006153.6E-227088No hitNo description
PROSITE patternPS0068507389IPR003956Transcription factor, NFYB/HAP3, conserved site
PRINTSPR006153.6E-2289107No hitNo description
PRINTSPR006153.6E-22108126No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 205 aa     Download sequence    Send to blast
MVCAVMMMDL GFLEGGAGMA DAGHDESGSP PRSGGVREQD RFLPIANISR IMKKAVPANG  60
KIAKDAKETL QECVSEFISF VTSEASDKCQ KEKRKTINGE DLLFAMGTLG FEEYVDPLKI  120
YLHKYREGDS KLSSKAGDGS VKKDTIGPHS GASSSSAQGM VGAYTQGMGY MQPQSNFHIL  180
VVLQSFAFPY MYQVAQIYCK YPSIE
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4g91_B5e-4836127192Transcription factor HapC (Eurofung)
4g92_B5e-4836127192Transcription factor HapC (Eurofung)
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY3324660.0AY332466.1 Oryza sativa (japonica cultivar-group) CCAAT-binding protein (CCB1) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015611518.11e-111PREDICTED: nuclear transcription factor Y subunit B-2 isoform X1
SwissprotQ5QMG31e-114NFYB2_ORYSJ; Nuclear transcription factor Y subunit B-2
TrEMBLA0A0E0C9Y21e-152A0A0E0C9Y2_9ORYZ; Uncharacterized protein
STRINGLOC_Os01g61810.11e-137(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP20138331
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G37060.35e-65nuclear factor Y, subunit B8